Lineage for d4kueb1 (4kue B:1-183)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846566Species Clostridium butyricum [TaxId:632245] [256900] (4 PDB entries)
  8. 2846572Domain d4kueb1: 4kue B:1-183 [262852]
    Other proteins in same PDB: d4kuea2, d4kueb2, d4kuec2, d4kued2
    automated match to d4kuea1

Details for d4kueb1

PDB Entry: 4kue (more details), 2 Å

PDB Description: crystal structure of 3-hydroxybutylryl-coa dehydrogenase from clostridium butyricum
PDB Compounds: (B:) 3-hydroxybutyryl-CoA dehydrogenase

SCOPe Domain Sequences for d4kueb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kueb1 c.2.1.0 (B:1-183) automated matches {Clostridium butyricum [TaxId: 632245]}
mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
eap

SCOPe Domain Coordinates for d4kueb1:

Click to download the PDB-style file with coordinates for d4kueb1.
(The format of our PDB-style files is described here.)

Timeline for d4kueb1: