Lineage for d4ksoc_ (4kso C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878824Family c.47.1.15: KaiB-like [102449] (3 proteins)
    Pfam PF07689; contains members with alternative folds
  6. 2878829Protein Circadian oscillation regulator KaiB [102450] (2 species)
    the differently folded C-terminal half facilitates oligomerization
  7. 2878833Species Synechococcus elongatus [TaxId:1140] [254871] (1 PDB entry)
  8. 2878836Domain d4ksoc_: 4kso C: [262851]
    automated match to d4ksob_

Details for d4ksoc_

PDB Entry: 4kso (more details), 2.62 Å

PDB Description: Crystal Structure of Circadian clock protein KaiB from S.Elongatus
PDB Compounds: (C:) Circadian clock protein kaiB

SCOPe Domain Sequences for d4ksoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ksoc_ c.47.1.15 (C:) Circadian oscillation regulator KaiB {Synechococcus elongatus [TaxId: 1140]}
msprktyilklyvagntpnsvralktlknilevefqgvyalkvidvlknpqlaeedkila
tptlakvlplpvrriigdlsdrekvligldllygelqdsddf

SCOPe Domain Coordinates for d4ksoc_:

Click to download the PDB-style file with coordinates for d4ksoc_.
(The format of our PDB-style files is described here.)

Timeline for d4ksoc_: