![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.15: KaiB-like [102449] (3 proteins) Pfam PF07689; contains members with alternative folds |
![]() | Protein Circadian oscillation regulator KaiB [102450] (2 species) the differently folded C-terminal half facilitates oligomerization |
![]() | Species Synechococcus elongatus [TaxId:1140] [254871] (1 PDB entry) |
![]() | Domain d4ksoc_: 4kso C: [262851] automated match to d4ksob_ |
PDB Entry: 4kso (more details), 2.62 Å
SCOPe Domain Sequences for d4ksoc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ksoc_ c.47.1.15 (C:) Circadian oscillation regulator KaiB {Synechococcus elongatus [TaxId: 1140]} msprktyilklyvagntpnsvralktlknilevefqgvyalkvidvlknpqlaeedkila tptlakvlplpvrriigdlsdrekvligldllygelqdsddf
Timeline for d4ksoc_: