Lineage for d4ko9d_ (4ko9 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770478Protein Azurin [49530] (6 species)
  7. 2770509Species Pseudomonas aeruginosa [TaxId:287] [49533] (96 PDB entries)
    Uniprot P00282
  8. 2770666Domain d4ko9d_: 4ko9 D: [262846]
    automated match to d4ko9a_
    complexed with cu

Details for d4ko9d_

PDB Entry: 4ko9 (more details), 2.05 Å

PDB Description: Investigating the functional significance of the interlocked pair structural determinants in Pseudomonas aeruginosa azurin (V95I/Y108F)
PDB Compounds: (D:) Azurin

SCOPe Domain Sequences for d4ko9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ko9d_ b.6.1.1 (D:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsitfdvsklkegeqfmffctfpghsal
mkgtltlk

SCOPe Domain Coordinates for d4ko9d_:

Click to download the PDB-style file with coordinates for d4ko9d_.
(The format of our PDB-style files is described here.)

Timeline for d4ko9d_: