Lineage for d4ko7c_ (4ko7 C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2380194Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2380272Protein Azurin [49530] (6 species)
  7. 2380303Species Pseudomonas aeruginosa [TaxId:287] [49533] (96 PDB entries)
    Uniprot P00282
  8. 2380526Domain d4ko7c_: 4ko7 C: [262842]
    automated match to d4ko7a_
    complexed with cu

Details for d4ko7c_

PDB Entry: 4ko7 (more details), 2.07 Å

PDB Description: investigating the functional significance of the interlocked pair structural determinants in pseudomonas aeruginosa azurin (v31i/w48f/v95i)
PDB Compounds: (C:) Azurin

SCOPe Domain Sequences for d4ko7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ko7c_ b.6.1.1 (C:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaitvdksckqftinlshpgnlpknvmghnfvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsitfdvsklkegeqymffctfpghsal
mkgtltlk

SCOPe Domain Coordinates for d4ko7c_:

Click to download the PDB-style file with coordinates for d4ko7c_.
(The format of our PDB-style files is described here.)

Timeline for d4ko7c_: