Lineage for d1fv9a_ (1fv9 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2387819Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2389445Protein Urokinase [50542] (1 species)
  7. 2389446Species Human (Homo sapiens) [TaxId:9606] [50543] (1 PDB entry)
  8. 2389447Domain d1fv9a_: 1fv9 A: [26283]
    complexed with 172, so4

Details for d1fv9a_

PDB Entry: 1fv9 (more details), 3 Å

PDB Description: crystal structure of human microurokinase in complex with 2-amino-5- hydroxy-benzimidazole
PDB Compounds: (A:) urokinase

SCOPe Domain Sequences for d1fv9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fv9a_ b.47.1.2 (A:) Urokinase {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
alpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irsht

SCOPe Domain Coordinates for d1fv9a_:

Click to download the PDB-style file with coordinates for d1fv9a_.
(The format of our PDB-style files is described here.)

Timeline for d1fv9a_: