SCOPe 2.06: Domain d4kb3g_: 4kb3 G:

Lineage for d4kb3g_ (4kb3 G:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein automated matches [190100] (19 species)
   not a true protein

7. Species Leishmania braziliensis [TaxId:5660] [256848] (2 PDB entries)

8. Domain d4kb3g_: 4kb3 G: [262818]
   automated match to d1qmva_

Details for d4kb3g_

PDB Entry: 4kb3, 2.93 Å

PDB Description: Crystal structure of the mitochondrial peroxiredoxin from Leishmania braziliensis in the decameric form

PDB Compounds: (G:) Peroxidoxin

SCOPe Domain Sequences for d4kb3g_:

Sequence; same for both SEQRES and ATOM records:

>d4kb3g_ c.47.1.10 (G:) automated matches {Leishmania braziliensis [TaxId: 5660]}
atvrdpapqfsgkavvdgaikeinsndykgkyivlffypmdftfvcpteiiafsdrylef
eklntqviavscdseyshlawvntprkkgglgemkipvladksmeiardygvliesagia
lrglfvidkkgtlrhstindlpvgrnvdevlrvveafqyaden

Timeline for d4kb3g_:

• d4kb3g_ first appeared in SCOPe 2.05
  
• d4kb3g_ appears in SCOPe 2.07
  
• d4kb3g_ appears in the current release, SCOPe 2.08