Lineage for d4k6oc_ (4k6o C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2125403Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2125404Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 protein domains)
  6. 2125805Protein Uridine phosphorylase [53176] (6 species)
  7. 2126047Species Vibrio cholerae [TaxId:243277] [224899] (14 PDB entries)
  8. 2126050Domain d4k6oc_: 4k6o C: [262810]
    automated match to d4k6oa_
    complexed with 6mu, cl, edo, eoh, gol, mg, na, trs

Details for d4k6oc_

PDB Entry: 4k6o (more details), 1.17 Å

PDB Description: X-ray structure uridine phosphorylase from Vibrio cholerae in complex with 6-methyluracil at 1.17 A resolution
PDB Compounds: (C:) Uridine phosphorylase

SCOPe Domain Sequences for d4k6oc_:

Sequence, based on SEQRES records: (download)

>d4k6oc_ c.56.2.1 (C:) Uridine phosphorylase {Vibrio cholerae [TaxId: 243277]}
ktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvv
vcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhf
apmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgs
mkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsik
vvveaarkmlk

Sequence, based on observed residues (ATOM records): (download)

>d4k6oc_ c.56.2.1 (C:) Uridine phosphorylase {Vibrio cholerae [TaxId: 243277]}
ktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvv
vcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhf
apmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgs
mkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdketearsikvvve
aarkmlk

SCOPe Domain Coordinates for d4k6oc_:

Click to download the PDB-style file with coordinates for d4k6oc_.
(The format of our PDB-style files is described here.)

Timeline for d4k6oc_: