SCOP 1.75: Domain d1elta_: 1elt A:

Lineage for d1elta_ (1elt A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Salmon (Salmo salar) [TaxId:8030] [50539] (1 PDB entry)

8. Domain d1elta_: 1elt A: [26281]
   complexed with ca

Details for d1elta_

PDB Entry: 1elt, 1.61 Å

PDB Description: structure of native pancreatic elastase from north atlantic salmon at 1.61 angstroms resolution

PDB Compounds: (A:) elastase

SCOP Domain Sequences for d1elta_:

Sequence; same for both SEQRES and ATOM records:

>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]}
vvggrvaqpnswpwqislqyksgssyyhtcggslirqgwvmtaahcvdsartwrvvlgeh
nlntnegkeqimtvnsvfihsgwnsddvaggydiallrlntqaslnsavqlaalppsnqi
lpnnnpcyitgwgktstggplsdslkqawlpsvdhatcsssgwwgstvkttmvcagggan
sgcngdsggplncqvngsyyvhgvtsfvsssgcnaskkptvftrvsayiswmngim

Timeline for d1elta_:

• d1elta_ first appeared (with stable ids) in SCOP 1.55, called d1elt__
  
• d1elta_ appears in SCOP 1.73
  
• d1elta_ appears in SCOPe 2.01
  
• d1elta_ appears in the current release, SCOPe 2.08