Lineage for d4k4hi1 (4k4h I:249-328)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001088Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2001491Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2001492Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 2001661Protein DNA polymerase lambda [101251] (1 species)
  7. 2001662Species Human (Homo sapiens) [TaxId:9606] [101252] (28 PDB entries)
  8. 2001699Domain d4k4hi1: 4k4h I:249-328 [262803]
    Other proteins in same PDB: d4k4ha2, d4k4ha3, d4k4ha4, d4k4he2, d4k4he3, d4k4he4, d4k4hi2, d4k4hi3, d4k4hi4, d4k4hm2, d4k4hm3, d4k4hm4
    automated match to d3hw8a1
    protein/DNA complex; complexed with 1rz, act, ca

Details for d4k4hi1

PDB Entry: 4k4h (more details), 2.1 Å

PDB Description: ternary crystal structures of a human dna polymerase lambda in complex with dna and (-)3tc-tp.
PDB Compounds: (I:) DNA polymerase lambda

SCOPe Domain Sequences for d4k4hi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k4hi1 a.60.6.1 (I:249-328) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
atnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkr
maekiieilesghlrkldhi

SCOPe Domain Coordinates for d4k4hi1:

Click to download the PDB-style file with coordinates for d4k4hi1.
(The format of our PDB-style files is described here.)

Timeline for d4k4hi1: