| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) ![]() contains one classic and one pseudo HhH motifs |
| Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins) |
| Protein DNA polymerase lambda [101251] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [101252] (28 PDB entries) |
| Domain d4k4ha1: 4k4h A:249-328 [262800] Other proteins in same PDB: d4k4ha2, d4k4ha3, d4k4ha4, d4k4he2, d4k4he3, d4k4he4, d4k4hi2, d4k4hi3, d4k4hi4, d4k4hm2, d4k4hm3, d4k4hm4 automated match to d3hw8a1 protein/DNA complex; complexed with 1rz, act, ca |
PDB Entry: 4k4h (more details), 2.1 Å
SCOPe Domain Sequences for d4k4ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k4ha1 a.60.6.1 (A:249-328) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
atnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkr
maekiieilesghlrkldhi
Timeline for d4k4ha1: