Lineage for d4k4ha1 (4k4h A:249-328)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715906Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2715907Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 2716076Protein DNA polymerase lambda [101251] (1 species)
  7. 2716077Species Human (Homo sapiens) [TaxId:9606] [101252] (28 PDB entries)
  8. 2716100Domain d4k4ha1: 4k4h A:249-328 [262800]
    Other proteins in same PDB: d4k4ha2, d4k4ha3, d4k4ha4, d4k4he2, d4k4he3, d4k4he4, d4k4hi2, d4k4hi3, d4k4hi4, d4k4hm2, d4k4hm3, d4k4hm4
    automated match to d3hw8a1
    protein/DNA complex; complexed with 1rz, act, ca

Details for d4k4ha1

PDB Entry: 4k4h (more details), 2.1 Å

PDB Description: ternary crystal structures of a human dna polymerase lambda in complex with dna and (-)3tc-tp.
PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d4k4ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k4ha1 a.60.6.1 (A:249-328) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
atnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkr
maekiieilesghlrkldhi

SCOPe Domain Coordinates for d4k4ha1:

Click to download the PDB-style file with coordinates for d4k4ha1.
(The format of our PDB-style files is described here.)

Timeline for d4k4ha1: