SCOPe 2.07: Domain d1esta_: 1est A:

Lineage for d1esta_ (1est A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (123 PDB entries)

8. Domain d1esta_: 1est A: [26280]
   complexed with so4, tsu

Details for d1esta_

PDB Entry: 1est, 2.5 Å

PDB Description: the atomic structure of crystalline porcine pancreatic elastase at 2.5 angstroms resolution. comparisons with the structure of alpha-chymotrypsin

PDB Compounds: (A:) porcine pancreatic elastase

SCOPe Domain Sequences for d1esta_:

Sequence; same for both SEQRES and ATOM records:

>d1esta_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

Timeline for d1esta_:

• d1esta_ first appeared (with stable ids) in SCOP 1.55, called d1est__
  
• d1esta_ appears in SCOPe 2.06
  
• d1esta_ appears in the current release, SCOPe 2.08