Lineage for d4k4gi2 (4k4g I:329-385)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737577Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1738431Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1738432Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
    automatically mapped to Pfam PF10391
  6. 1738609Protein DNA polymerase lambda [101253] (1 species)
  7. 1738610Species Human (Homo sapiens) [TaxId:9606] [101254] (26 PDB entries)
  8. 1738650Domain d4k4gi2: 4k4g I:329-385 [262795]
    Other proteins in same PDB: d4k4ga1, d4k4ga3, d4k4ge1, d4k4ge3, d4k4gi1, d4k4gi3, d4k4gm1, d4k4gm3
    automated match to d2bcqa2
    protein/DNA complex; complexed with 1s0, act, ca, cac

Details for d4k4gi2

PDB Entry: 4k4g (more details), 2.15 Å

PDB Description: ternary crystal structures of human dna polymerase lambda in complex with dna and l-dctp.
PDB Compounds: (I:) DNA polymerase lambda

SCOPe Domain Sequences for d4k4gi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k4gi2 a.60.12.1 (I:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle

SCOPe Domain Coordinates for d4k4gi2:

Click to download the PDB-style file with coordinates for d4k4gi2.
(The format of our PDB-style files is described here.)

Timeline for d4k4gi2: