Lineage for d4k4db_ (4k4d B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943854Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 2943965Protein automated matches [190102] (7 species)
    not a true protein
  7. 2943989Species Escherichia coli [TaxId:83333] [257785] (2 PDB entries)
  8. 2943995Domain d4k4db_: 4k4d B: [262793]
    automated match to d4k4ca_
    complexed with act, hfq, mli

Details for d4k4db_

PDB Entry: 4k4d (more details), 2.17 Å

PDB Description: X-ray crystal structure of E. coli YbdB complexed with 2,4-dihydroxyphenacyl-CoA
PDB Compounds: (B:) Proofreading thioesterase EntH

SCOPe Domain Sequences for d4k4db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k4db_ d.38.1.5 (B:) automated matches {Escherichia coli [TaxId: 83333]}
miwkrhltldelnatsdntmvahlgivytrlgddvleaempvdtrthqpfgllhggasaa
laetlgsmagfmmtrdgqcvvgtelnathhrpvsegkvrgvcqplhlgrqnqsweivvfd
eqgrrcctcrlgtavlg

SCOPe Domain Coordinates for d4k4db_:

Click to download the PDB-style file with coordinates for d4k4db_.
(The format of our PDB-style files is described here.)

Timeline for d4k4db_: