Lineage for d4k4bf_ (4k4b F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943854Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 2943910Protein Hypothetical protein YdiI [102910] (1 species)
  7. 2943911Species Escherichia coli [TaxId:562] [102911] (6 PDB entries)
  8. 2943931Domain d4k4bf_: 4k4b F: [262790]
    automated match to d1sbka_
    complexed with cl, uoq

Details for d4k4bf_

PDB Entry: 4k4b (more details), 1.9 Å

PDB Description: X-ray crystal structure of E. coli YdiI complexed with undeca-2-one-CoA
PDB Compounds: (F:) Esterase YdiI

SCOPe Domain Sequences for d4k4bf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k4bf_ d.38.1.5 (F:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]}
miwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasvv
laesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieifd
ekgrlccssrlttail

SCOPe Domain Coordinates for d4k4bf_:

Click to download the PDB-style file with coordinates for d4k4bf_.
(The format of our PDB-style files is described here.)

Timeline for d4k4bf_: