Lineage for d4juqc_ (4juq C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1925531Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 1925532Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 1925533Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 1925666Protein automated matches [195197] (4 species)
    not a true protein
  7. 1925677Species Pseudomonas aeruginosa [TaxId:208964] [226711] (3 PDB entries)
  8. 1925688Domain d4juqc_: 4juq C: [262780]
    automated match to d4fo8c_
    complexed with mn; mutant

Details for d4juqc_

PDB Entry: 4juq (more details), 2.2 Å

PDB Description: Pseudomonas aeruginosa MetAP T2N mutant, in Mn form
PDB Compounds: (C:) Methionine aminopeptidase

SCOPe Domain Sequences for d4juqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4juqc_ d.127.1.1 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
nvtiktpddiekmriagrlaaevlemigehikpgvtteeldrichdyivneqkaipapln
ykgfpksictsinhvvchgipnekplkegdilnvditvikdgyhgdtskmflvgktpewa
drlcqitqecmykgisvvrpgahlgdigeiiqkhaekngfsvvreycghgigkvfheepq
vlhygragtgielkegmiftiepminqgrpetrllgdgwtaitkdrklsaqwehtvlvta
dgyeiltlrndetfprts

SCOPe Domain Coordinates for d4juqc_:

Click to download the PDB-style file with coordinates for d4juqc_.
(The format of our PDB-style files is described here.)

Timeline for d4juqc_: