Lineage for d1eaib_ (1eai B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) 
Protein Elastase [50536] (3 species) Species Pig (Sus scrofa) [TaxId:9823] [50538] (42 PDB entries) 
Domain d1eaib_: 1eai B: [26278]
Other proteins in same PDB: d1eaic_, d1eaid_
Details for d1eaib_
PDB Entry: 1eai (more details), 2.4 Å
PDB Description: complex of ascaris chymotrpsin/elastase inhibitor with porcine elastase
SCOP Domain Sequences for d1eaib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eaib_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa)}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn
SCOP Domain Coordinates for d1eaib_:
Click to download the PDB-style file with coordinates for d1eaib_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eaib_:
- d1eaib_ appears in SCOP 1.57
- d1eaib_ appears in the current release, SCOPe 2.08
View in 3D
