SCOPe 2.05: Domain d4julm_: 4jul M:

Lineage for d4julm_ (4jul M:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (33 species)
   not a true protein

7. Species Influenza a virus [TaxId:393616] [267957] (1 PDB entry)

8. Domain d4julm_: 4jul M: [262778]
   Other proteins in same PDB: d4jula_, d4julc_, d4jule_, d4julh_, d4julj_, d4jull_
   automated match to d3gbmb_
   complexed with nag

Details for d4julm_

PDB Entry: 4jul, 2.79 Å

PDB Description: crystal structure of h5n1 influenza virus hemagglutinin, clade 2.3.4

PDB Compounds: (M:) hemagglutinin HA2

SCOPe Domain Sequences for d4julm_:

Sequence; same for both SEQRES and ATOM records:

>d4julm_ h.3.1.1 (M:) automated matches {Influenza a virus [TaxId: 393616]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlk

Timeline for d4julm_:

• d4julm_ is new in SCOPe 2.05-stable
  
• d4julm_ appears in SCOPe 2.06
  
• d4julm_ appears in the current release, SCOPe 2.08