Class b: All beta proteins [48724] (176 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein Hemagglutinin [49824] (7 species) includes rudiment esterase domain |
Species Influenza A virus, different strains [TaxId:11320] [49825] (105 PDB entries) |
Domain d4jull_: 4jul L: [262777] Other proteins in same PDB: d4julb_, d4juld_, d4julf_, d4juli_, d4julk_, d4julm_ automated match to d3gbna_ complexed with nag |
PDB Entry: 4jul (more details), 2.79 Å
SCOPe Domain Sequences for d4jull_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jull_ b.19.1.2 (L:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]} qicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagwl lgnpmcdefinvpewsyivekanpandlcypgnfndyeelkhllsrinhfekiqiipkss wsdheassgvssacpyqgtpsffrnvvwlikknntyptikrsynntnqedllilwgihhs ndaaeqtklyqnpttyisvgtstlnqrlvpkiatrskvngqsgrmdffwtilkpndainf esngnfiapeyaykivkkgdsaiikseveygncntkcqtpigainssmpfhnihpltige cpkyvksnklvlatglrns
Timeline for d4jull_: