Lineage for d4jull_ (4jul L:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775631Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)
  8. 2775926Domain d4jull_: 4jul L: [262777]
    Other proteins in same PDB: d4jula2, d4julb_, d4julc2, d4juld_, d4jule2, d4julf_, d4julh2, d4juli_, d4julj2, d4julk_, d4julm_
    automated match to d3gbna_
    complexed with nag

Details for d4jull_

PDB Entry: 4jul (more details), 2.79 Å

PDB Description: crystal structure of h5n1 influenza virus hemagglutinin, clade 2.3.4
PDB Compounds: (L:) hemagglutinin HA1

SCOPe Domain Sequences for d4jull_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jull_ b.19.1.2 (L:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
qicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagwl
lgnpmcdefinvpewsyivekanpandlcypgnfndyeelkhllsrinhfekiqiipkss
wsdheassgvssacpyqgtpsffrnvvwlikknntyptikrsynntnqedllilwgihhs
ndaaeqtklyqnpttyisvgtstlnqrlvpkiatrskvngqsgrmdffwtilkpndainf
esngnfiapeyaykivkkgdsaiikseveygncntkcqtpigainssmpfhnihpltige
cpkyvksnklvlatglrns

SCOPe Domain Coordinates for d4jull_:

Click to download the PDB-style file with coordinates for d4jull_.
(The format of our PDB-style files is described here.)

Timeline for d4jull_: