Lineage for d4julj_ (4jul J:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778136Protein Hemagglutinin [49824] (7 species)
    includes rudiment esterase domain
  7. 1778153Species Influenza A virus, different strains [TaxId:11320] [49825] (105 PDB entries)
  8. 1778405Domain d4julj_: 4jul J: [262775]
    Other proteins in same PDB: d4julb_, d4juld_, d4julf_, d4juli_, d4julk_, d4julm_
    automated match to d3gbna_
    complexed with nag

Details for d4julj_

PDB Entry: 4jul (more details), 2.79 Å

PDB Description: Crystal structure of H5N1 influenza virus hemagglutinin, clade 2.3.4
PDB Compounds: (J:) hemagglutinin HA1

SCOPe Domain Sequences for d4julj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4julj_ b.19.1.2 (J:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
gdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvag
wllgnpmcdefinvpewsyivekanpandlcypgnfndyeelkhllsrinhfekiqiipk
sswsdheassgvssacpyqgtpsffrnvvwlikknntyptikrsynntnqedllilwgih
hsndaaeqtklyqnpttyisvgtstlnqrlvpkiatrskvngqsgrmdffwtilkpndai
nfesngnfiapeyaykivkkgdsaiikseveygncntkcqtpigainssmpfhnihplti
gecpkyvksnklvlatglrns

SCOPe Domain Coordinates for d4julj_:

Click to download the PDB-style file with coordinates for d4julj_.
(The format of our PDB-style files is described here.)

Timeline for d4julj_: