Lineage for d4julf_ (4jul F:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969953Protein automated matches [254646] (33 species)
    not a true protein
  7. 1970155Species Influenza a virus [TaxId:393616] [267957] (1 PDB entry)
  8. 1970158Domain d4julf_: 4jul F: [262772]
    Other proteins in same PDB: d4jula_, d4julc_, d4jule_, d4julh_, d4julj_, d4jull_
    automated match to d3gbmb_
    complexed with nag

Details for d4julf_

PDB Entry: 4jul (more details), 2.79 Å

PDB Description: crystal structure of h5n1 influenza virus hemagglutinin, clade 2.3.4
PDB Compounds: (F:) hemagglutinin HA2

SCOPe Domain Sequences for d4julf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4julf_ h.3.1.1 (F:) automated matches {Influenza a virus [TaxId: 393616]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkree

SCOPe Domain Coordinates for d4julf_:

Click to download the PDB-style file with coordinates for d4julf_.
(The format of our PDB-style files is described here.)

Timeline for d4julf_: