SCOPe 2.05: Domain d4jule_: 4jul E:

Lineage for d4jule_ (4jul E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (7 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (105 PDB entries)

8. Domain d4jule_: 4jul E: [262771]
   Other proteins in same PDB: d4julb_, d4juld_, d4julf_, d4juli_, d4julk_, d4julm_
   automated match to d3gbna_
   complexed with nag

Details for d4jule_

PDB Entry: 4jul, 2.79 Å

PDB Description: crystal structure of h5n1 influenza virus hemagglutinin, clade 2.3.4

PDB Compounds: (E:) hemagglutinin HA1

SCOPe Domain Sequences for d4jule_:

Sequence; same for both SEQRES and ATOM records:

>d4jule_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
pgdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsva
gwllgnpmcdefinvpewsyivekanpandlcypgnfndyeelkhllsrinhfekiqiip
ksswsdheassgvssacpyqgtpsffrnvvwlikknntyptikrsynntnqedllilwgi
hhsndaaeqtklyqnpttyisvgtstlnqrlvpkiatrskvngqsgrmdffwtilkpnda
infesngnfiapeyaykivkkgdsaiikseveygncntkcqtpigainssmpfhnihplt
igecpkyvksnklvlatglrns

Timeline for d4jule_:

• d4jule_ is new in SCOPe 2.05-stable
  
• d4jule_ is called d4jule1 in SCOPe 2.06
  
• d4jule_ appears in the current release, SCOPe 2.08, called d4jule1