SCOP 1.73: Domain d1esba_: 1esb A:

Lineage for d1esba_ (1esb A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (91 PDB entries)

8. Domain d1esba_: 1esb A: [26276]
   complexed with ca, cbz, so4

Details for d1esba_

PDB Entry: 1esb, 2.3 Å

PDB Description: direct structure observation of an acyl-enzyme intermediate in the hydrolysis of an ester substrate by elastase

PDB Compounds: (A:) porcine pancreatic elastase

SCOP Domain Sequences for d1esba_:

Sequence; same for both SEQRES and ATOM records:

>d1esba_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn
a

Timeline for d1esba_:

• d1esba_ first appeared (with stable ids) in SCOP 1.55, called d1esb__
  
• d1esba_ was called d1esb__ in SCOP 1.71
  
• d1esba_ appears in SCOP 1.75
  
• d1esba_ appears in the current release, SCOPe 2.08