SCOP 1.71: Domain d1esb__: 1esb -

Lineage for d1esb__ (1esb -)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (59 PDB entries)

8. Domain d1esb__: 1esb - [26276]
   complexed with ca, cbz, so4

Details for d1esb__

PDB Entry: 1esb, 2.3 Å

PDB Description: direct structure observation of an acyl-enzyme intermediate in the hydrolysis of an ester substrate by elastase

SCOP Domain Sequences for d1esb__:

Sequence; same for both SEQRES and ATOM records:

>d1esb__ b.47.1.2 (-) Elastase {Pig (Sus scrofa)}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn
a

Timeline for d1esb__:

• d1esb__ first appeared (with stable ids) in SCOP 1.55
  
• d1esb__ appears in SCOP 1.69
  
• d1esb__ is called d1esba_ in SCOP 1.73
  
• d1esb__ appears in the current release, SCOPe 2.08, called d1esba_