Lineage for d4jgzb_ (4jgz B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2086376Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2086604Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2087272Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2087273Protein automated matches [190988] (13 species)
    not a true protein
  7. 2087314Species Human coxsackievirus a16 [TaxId:31704] [256333] (2 PDB entries)
  8. 2087319Domain d4jgzb_: 4jgz B: [262756]
    automated match to d4rqpc_

Details for d4jgzb_

PDB Entry: 4jgz (more details), 3 Å

PDB Description: Crystal structure of human coxsackievirus A16 uncoating intermediate (space group I222)
PDB Compounds: (B:) Polyprotein, capsid protein VP2

SCOPe Domain Sequences for d4jgzb_:

Sequence, based on SEQRES records: (download)

>d4jgzb_ b.121.4.0 (B:) automated matches {Human coxsackievirus a16 [TaxId: 31704]}
acgysdrvaqltignstittqeaaniviaygewpeycpdtdatavdkptrpdvsvnrfft
ldtkswakdskgwywkfpdvltevgvfgqnaqfhylyrsgfcvhvqcnaskfhqgallva
vlpeyvlgtiaggtgnenshppyattqpgqvgavlthpyvldagiplsqltvcphqwinl
rtnncatiivpymntvpfdsalnhcnfgllvipvvpldfntgatseipitvtiapmcaef
aglr

Sequence, based on observed residues (ATOM records): (download)

>d4jgzb_ b.121.4.0 (B:) automated matches {Human coxsackievirus a16 [TaxId: 31704]}
acgysdrvaqltignstittqeaaniviaygewpeycpdtdatavdkptrpdvsvnrfft
ldtkswakdskgwywkfpdvltevgvfgqnaqfhylyrsgfcvhvqcnaskfhqgallva
vlpeyvlgtiaenshppyattqpgqvgavlthpyvldagiplsqltvcphqwinlrtnnc
atiivpymntvpfdsalnhcnfgllvipvvpldfntgatseipitvtiapmcaefaglr

SCOPe Domain Coordinates for d4jgzb_:

Click to download the PDB-style file with coordinates for d4jgzb_.
(The format of our PDB-style files is described here.)

Timeline for d4jgzb_: