SCOPe 2.05: Domain d4j8ea_: 4j8e A:

Lineage for d4j8ea_ (4j8e A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (9 families)

5. Family a.118.8.0: automated matches [191581] (1 protein)
   not a true family

6. Protein automated matches [191037] (10 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [256317] (1 PDB entry)

8. Domain d4j8ea_: 4j8e A: [262751]
   automated match to d4j8eb_
   complexed with gol

Details for d4j8ea_

PDB Entry: 4j8e, 2.6 Å

PDB Description: Middle domain of Hsc70-interacting protein, crystal form I

PDB Compounds: (A:) Hsc70-interacting protein

SCOPe Domain Sequences for d4j8ea_:

Sequence; same for both SEQRES and ATOM records:

>d4j8ea_ a.118.8.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
apqemgdenaeiteammdeanekkgaaidalndgelqkaidlftdaiklnprlailyakr
asvfvklqkpnaairdcdraieinpdsaqpykwrgkahrllghweeaardlalackldy

Timeline for d4j8ea_:

• d4j8ea_ is new in SCOPe 2.05-stable
  
• d4j8ea_ appears in SCOPe 2.06
  
• d4j8ea_ appears in the current release, SCOPe 2.08