Lineage for d4j8ea_ (4j8e A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726649Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. 2726989Family a.118.8.0: automated matches [191581] (1 protein)
    not a true family
  6. 2726990Protein automated matches [191037] (12 species)
    not a true protein
  7. 2727042Species Norway rat (Rattus norvegicus) [TaxId:10116] [256317] (1 PDB entry)
  8. 2727043Domain d4j8ea_: 4j8e A: [262751]
    automated match to d4j8eb_
    complexed with gol

Details for d4j8ea_

PDB Entry: 4j8e (more details), 2.6 Å

PDB Description: Middle domain of Hsc70-interacting protein, crystal form I
PDB Compounds: (A:) Hsc70-interacting protein

SCOPe Domain Sequences for d4j8ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j8ea_ a.118.8.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
apqemgdenaeiteammdeanekkgaaidalndgelqkaidlftdaiklnprlailyakr
asvfvklqkpnaairdcdraieinpdsaqpykwrgkahrllghweeaardlalackldy

SCOPe Domain Coordinates for d4j8ea_:

Click to download the PDB-style file with coordinates for d4j8ea_.
(The format of our PDB-style files is described here.)

Timeline for d4j8ea_: