Lineage for d4j4pa3 (4j4p A:439-543)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758275Domain d4j4pa3: 4j4p A:439-543 [262745]
    Other proteins in same PDB: d4j4pd2, d4j4pl2
    automated match to d1o0va3

Details for d4j4pa3

PDB Entry: 4j4p (more details), 2.91 Å

PDB Description: the complex of human ige-fc with two bound fab fragments
PDB Compounds: (A:) ig epsilon chain c region

SCOPe Domain Sequences for d4j4pa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j4pa3 b.1.1.0 (A:439-543) automated matches {Human (Homo sapiens) [TaxId: 9606]}
praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt
kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsv

SCOPe Domain Coordinates for d4j4pa3:

Click to download the PDB-style file with coordinates for d4j4pa3.
(The format of our PDB-style files is described here.)

Timeline for d4j4pa3: