SCOPe 2.05: Domain d4iuds_: 4iud S:

Lineage for d4iuds_ (4iud S:)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
   2 domains: (1) alpa/beta; (2) Fe-S cluster-bound

4. Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families)

5. Family e.19.1.0: automated matches [191636] (1 protein)
   not a true family

6. Protein automated matches [191172] (5 species)
   not a true protein

7. Species Ralstonia eutropha [TaxId:381666] [256057] (5 PDB entries)

8. Domain d4iuds_: 4iud S: [262735]
   Other proteins in same PDB: d4iudl_
   automated match to d3rgws_
   complexed with cl, f3s, mg, nfv, s3f, sf4

Details for d4iuds_

PDB Entry: 4iud, 1.45 Å

PDB Description: crystal structure of an o2-tolerant [nife]-hydrogenase from ralstonia eutropha in its as-isolated form with ascorbate - partly reduced state

PDB Compounds: (S:) Uptake hydrogenase small subunit

SCOPe Domain Sequences for d4iuds_:

Sequence; same for both SEQRES and ATOM records:

>d4iuds_ e.19.1.0 (S:) automated matches {Ralstonia eutropha [TaxId: 381666]}
prtpvlwlhglectccsesfirsahplakdvvlsmisldyddtlmaaaghqaeaileeim
tkykgnyilavegnpplnqdgmsciiggrpfieqlkyvakdakaiiswgscaswgcvqaa
kpnptqatpvhkvitdkpiikvpgcppiaevmtgvitymltfdripeldrqgrpkmfysq
rihdkcyrrphfdagqfveewddesarkgfclykmgckgpttynacsttrwnegtsfpiq
sghgcigcsedgfwdkgsfydrltg

Timeline for d4iuds_:

• d4iuds_ is new in SCOPe 2.05-stable
  
• d4iuds_ appears in SCOPe 2.06
  
• d4iuds_ appears in the current release, SCOPe 2.08