Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.19: HydA/Nqo6-like [56769] (1 superfamily) 2 domains: (1) alpa/beta; (2) Fe-S cluster-bound |
Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) |
Family e.19.1.0: automated matches [191636] (1 protein) not a true family |
Protein automated matches [191172] (5 species) not a true protein |
Species Ralstonia eutropha [TaxId:381666] [256057] (5 PDB entries) |
Domain d4iucs_: 4iuc S: [262734] Other proteins in same PDB: d4iucl_ automated match to d3rgws_ complexed with cl, f3s, mg, nfv, s3f, sf4 |
PDB Entry: 4iuc (more details), 1.45 Å
SCOPe Domain Sequences for d4iucs_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iucs_ e.19.1.0 (S:) automated matches {Ralstonia eutropha [TaxId: 381666]} prtpvlwlhglectccsesfirsahplakdvvlsmisldyddtlmaaaghqaeaileeim tkykgnyilavegnpplnqdgmsciiggrpfieqlkyvakdakaiiswgscaswgcvqaa kpnptqatpvhkvitdkpiikvpgcppiaevmtgvitymltfdripeldrqgrpkmfysq rihdkcyrrphfdagqfveewddesarkgfclykmgckgpttynacsttrwnegtsfpiq sghgcigcsedgfwdkgsfydrltg
Timeline for d4iucs_: