SCOPe 2.05: Domain d4im9b_: 4im9 B:

Lineage for d4im9b_ (4im9 B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.236: DNA primase DnaG, C-terminal domain [117022] (1 superfamily)
   multihelical; segment-swapped dimer

4. Superfamily a.236.1: DNA primase DnaG, C-terminal domain [117023] (2 families)
   automatically mapped to Pfam PF08278

5. Family a.236.1.0: automated matches [256784] (1 protein)
   not a true family

6. Protein automated matches [256785] (1 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:345073] [256786] (1 PDB entry)

8. Domain d4im9b_: 4im9 B: [262727]
   automated match to d4im9a_
   protein/DNA complex

Details for d4im9b_

PDB Entry: 4im9, 2.46 Å

PDB Description: Cystal structure of DnaG primase C-terminal domain from Vibrio cholerae

PDB Compounds: (B:) DNA primase

SCOPe Domain Sequences for d4im9b_:

Sequence, based on SEQRES records:

>d4im9b_ a.236.1.0 (B:) automated matches {Vibrio cholerae [TaxId: 345073]}
rtpmrdvialliqnpsyaelvpdlasvrhlmipgldtfsevlekcrqyphittgqllehw
rdsknetllsrlasweiplvednqeelfldsldkilaqcvekqienlqakersvglstee
krelqdlilkglkalehh

Sequence, based on observed residues (ATOM records):

>d4im9b_ a.236.1.0 (B:) automated matches {Vibrio cholerae [TaxId: 345073]}
rtpmrdvialliqnpsyaelvpdlasvrhlmipgldtfsevlekcrqyphittgqllehw
rdsknetllsrlasweiplnqeelfldsldkilaqcvekqienlqakersvglsteekre
lqdlilkglkalehh

Timeline for d4im9b_:

• d4im9b_ is new in SCOPe 2.05-stable
  
• d4im9b_ is called d4im9b1 in SCOPe 2.06
  
• d4im9b_ appears in the current release, SCOPe 2.08, called d4im9b1