| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
| Protein automated matches [190435] (12 species) not a true protein |
| Species Escherichia coli [TaxId:511145] [189613] (7 PDB entries) |
| Domain d4ii4c1: 4ii4 C:2-248 [262722] Other proteins in same PDB: d4ii4b2, d4ii4c2 automated match to d3pvtc_ complexed with byc; mutant |
PDB Entry: 4ii4 (more details), 2.8 Å
SCOPe Domain Sequences for d4ii4c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ii4c1 a.25.1.2 (C:2-248) automated matches {Escherichia coli [TaxId: 511145]}
nqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaaelag
egdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpqlaa
isakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidialse
egiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemqylqr
vlpgqqw
Timeline for d4ii4c1: