SCOPe 2.08: Domain d4igme_: 4igm E:

Lineage for d4igme_ (4igm E:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.0: automated matches [191327] (1 protein)
   not a true family

6. Protein automated matches [190150] (36 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189102] (8 PDB entries)

8. Domain d4igme_: 4igm E: [262720]
   automated match to d4ofca_
   complexed with zn

Details for d4igme_

PDB Entry: 4igm, 2.39 Å

PDB Description: 2.39 angstrom x-ray crystal structure of human acmsd

PDB Compounds: (E:) 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase

SCOPe Domain Sequences for d4igme_:

Sequence; same for both SEQRES and ATOM records:

>d4igme_ c.1.9.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkidihshilpkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvrencwdpevri
remdqkgvtvqalstvpvmfsywakpedtlnlcqllnndlastvvsyprrfvglgtlpmq
apelavkemercvkelgfpgvqigthvnewdlnaqelfpvyaaaerlkcslfvhpwdmqm
dgrmakywlpwlvgmpaettiaicsmimggvfekfpklkvcfahgggafpftvgrishgf
smrpdlcaqdnpmnpkkylgsfytdalvhdplslklltdvigkdkvilgtdypfplgele
pgkliesmeefdeetknklkagnalaflgler

Timeline for d4igme_:

• d4igme_ first appeared in SCOPe 2.05
  
• d4igme_ appears in SCOPe 2.07