SCOP 1.73: Domain d1elba_: 1elb A:

Lineage for d1elba_ (1elb A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (91 PDB entries)

8. Domain d1elba_: 1elb A: [26272]
   complexed with ca, iso, so4, tfa

Details for d1elba_

PDB Entry: 1elb, 2.1 Å

PDB Description: Analogous inhibitors of elastase do not always bind analogously

PDB Compounds: (A:) elastase

SCOP Domain Sequences for d1elba_:

Sequence; same for both SEQRES and ATOM records:

>d1elba_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

Timeline for d1elba_:

• d1elba_ first appeared (with stable ids) in SCOP 1.55
  
• d1elba_ appears in SCOP 1.71
  
• d1elba_ appears in SCOP 1.75
  
• d1elba_ appears in the current release, SCOPe 2.08