![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
![]() | Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) ![]() related to the ferredoxin reductase-like FAD-binding domain |
![]() | Family b.45.1.0: automated matches [191365] (1 protein) not a true family |
![]() | Protein automated matches [190439] (20 species) not a true protein |
![]() | Species Streptomyces globisporus [TaxId:1908] [256294] (2 PDB entries) |
![]() | Domain d4hx6f1: 4hx6 F:1-175 [262713] Other proteins in same PDB: d4hx6a2, d4hx6c2, d4hx6d2, d4hx6f2 automated match to d4r82a_ complexed with act, so4 |
PDB Entry: 4hx6 (more details), 1.89 Å
SCOPe Domain Sequences for d4hx6f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hx6f1 b.45.1.0 (F:1-175) automated matches {Streptomyces globisporus [TaxId: 1908]} mspiiappaelvdpkdrvqlrrvfgdfptgvtvvtvggseprgmtansftsvslspplvl icvgkdavmhqrltalptfavsvleagqekaarhfadhshppgvdqfdtvdwvlgeesga pliagavahlecaihrlyeggdhtiflgevitatrwparegmlfsggrfrrfapd
Timeline for d4hx6f1: