Class b: All beta proteins [48724] (177 folds) |
Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) related to the ferredoxin reductase-like FAD-binding domain |
Family b.45.1.0: automated matches [191365] (1 protein) not a true family |
Protein automated matches [190439] (20 species) not a true protein |
Species Streptomyces globisporus [TaxId:1908] [256294] (2 PDB entries) |
Domain d4hx6c1: 4hx6 C:1-178 [262710] Other proteins in same PDB: d4hx6a2, d4hx6c2, d4hx6d2, d4hx6f2 automated match to d4r82a_ complexed with act, so4 |
PDB Entry: 4hx6 (more details), 1.89 Å
SCOPe Domain Sequences for d4hx6c1:
Sequence, based on SEQRES records: (download)
>d4hx6c1 b.45.1.0 (C:1-178) automated matches {Streptomyces globisporus [TaxId: 1908]} mspiiappaelvdpkdrvqlrrvfgdfptgvtvvtvggseprgmtansftsvslspplvl icvgkdavmhqrltalptfavsvleagqekaarhfadhshppgvdqfdtvdwvlgeesga pliagavahlecaihrlyeggdhtiflgevitatrwparegmlfsggrfrrfapdade
>d4hx6c1 b.45.1.0 (C:1-178) automated matches {Streptomyces globisporus [TaxId: 1908]} mspiiappaelvdpkdrvqlrrvfgdfptgvtvvtvggseprgmtansftsvslspplvl icvgkdavmhqrltalptfavsvleagqekaarhfaddqfdtvdwvlgeesgapliagav ahlecaihrlyeggdhtiflgevitatrwparegmlfsggrfrrfapdade
Timeline for d4hx6c1: