SCOPe 2.06: Domain d4hx6c1: 4hx6 C:1-178

Lineage for d4hx6c1 (4hx6 C:1-178)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.0: automated matches [191365] (1 protein)
   not a true family

6. Protein automated matches [190439] (20 species)
   not a true protein

7. Species Streptomyces globisporus [TaxId:1908] [256294] (2 PDB entries)

8. Domain d4hx6c1: 4hx6 C:1-178 [262710]
   Other proteins in same PDB: d4hx6a2, d4hx6c2, d4hx6d2, d4hx6f2
   automated match to d4r82a_
   complexed with act, so4

Details for d4hx6c1

PDB Entry: 4hx6, 1.89 Å

PDB Description: streptomyces globisporus c-1027 nadh:fad oxidoreductase sgce6

PDB Compounds: (C:) Oxidoreductase

SCOPe Domain Sequences for d4hx6c1:

Sequence, based on SEQRES records:

>d4hx6c1 b.45.1.0 (C:1-178) automated matches {Streptomyces globisporus [TaxId: 1908]}
mspiiappaelvdpkdrvqlrrvfgdfptgvtvvtvggseprgmtansftsvslspplvl
icvgkdavmhqrltalptfavsvleagqekaarhfadhshppgvdqfdtvdwvlgeesga
pliagavahlecaihrlyeggdhtiflgevitatrwparegmlfsggrfrrfapdade

Sequence, based on observed residues (ATOM records):

>d4hx6c1 b.45.1.0 (C:1-178) automated matches {Streptomyces globisporus [TaxId: 1908]}
mspiiappaelvdpkdrvqlrrvfgdfptgvtvvtvggseprgmtansftsvslspplvl
icvgkdavmhqrltalptfavsvleagqekaarhfaddqfdtvdwvlgeesgapliagav
ahlecaihrlyeggdhtiflgevitatrwparegmlfsggrfrrfapdade

Timeline for d4hx6c1:

• d4hx6c1 first appeared in SCOPe 2.05, called d4hx6c_
  
• d4hx6c1 appears in SCOPe 2.07
  
• d4hx6c1 appears in the current release, SCOPe 2.08