Lineage for d4euka_ (4euk A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2856140Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267930] (1 PDB entry)
  8. 2856141Domain d4euka_: 4euk A: [262702]
    Other proteins in same PDB: d4eukb_
    automated match to d1dcfa_
    complexed with edo, mg

Details for d4euka_

PDB Entry: 4euk (more details), 1.95 Å

PDB Description: crystal structure
PDB Compounds: (A:) Histidine kinase 5

SCOPe Domain Sequences for d4euka_:

Sequence, based on SEQRES records: (download)

>d4euka_ c.23.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
skpkillvednkinimvaksmmkqlghtmdianngveaitainsssydlvlmdvcmpvld
glkatrlirsyeetgnwnaaieagvdistseneqvcmrptnrlpiiamtantlaesseec
yangmdsfiskpvtlqklreclqqylh

Sequence, based on observed residues (ATOM records): (download)

>d4euka_ c.23.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
skpkillvednkinimvaksmmkqlghtmdianngveaitainsssydlvlmdvcmpvld
glkatrlirsyeetgnwnaaieagvdistnrlpiiamtantlaesseecyangmdsfisk
pvtlqklreclqqylh

SCOPe Domain Coordinates for d4euka_:

Click to download the PDB-style file with coordinates for d4euka_.
(The format of our PDB-style files is described here.)

Timeline for d4euka_: