Lineage for d1eata_ (1eat A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 953177Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 953496Protein Elastase [50536] (4 species)
  7. 953506Species Pig (Sus scrofa) [TaxId:9823] [50538] (114 PDB entries)
  8. 953596Domain d1eata_: 1eat A: [26270]
    complexed with na, so4, tfi

Details for d1eata_

PDB Entry: 1eat (more details), 2 Å

PDB Description: nonpeptidic inhibitors of human leukocyte elastase. 5. design, synthesis, and x-ray crystallography of a series of orally active 5-amino-pyrimidin-6-one-containing trifluoromethylketones
PDB Compounds: (A:) porcine pancreatic elastase

SCOPe Domain Sequences for d1eata_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eata_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOPe Domain Coordinates for d1eata_:

Click to download the PDB-style file with coordinates for d1eata_.
(The format of our PDB-style files is described here.)

Timeline for d1eata_: