![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
![]() | Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
![]() | Protein automated matches [190459] (59 species) not a true protein |
![]() | Species Trypanosoma brucei [TaxId:999953] [226467] (29 PDB entries) |
![]() | Domain d4eg3a1: 4eg3 A:239-606 [262696] Other proteins in same PDB: d4eg3a2, d4eg3b2, d4eg3b3 automated match to d4mvyb2 protein/RNA complex; complexed with gol, me8 |
PDB Entry: 4eg3 (more details), 2.94 Å
SCOPe Domain Sequences for d4eg3a1:
Sequence, based on SEQRES records: (download)
>d4eg3a1 c.26.1.0 (A:239-606) automated matches {Trypanosoma brucei [TaxId: 999953]} ekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkvaeaak qkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdiylgr yegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsafrerlle wyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwldal tnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsaglpl pkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdysdknm iarlngel
>d4eg3a1 c.26.1.0 (A:239-606) automated matches {Trypanosoma brucei [TaxId: 999953]} ekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkvaeaak qkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdiylgr yegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsafrerlle wyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwldal tnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsaglpl pkkivahgwwtkdrkkisksnvfdpvekaeefgydalkyfllresgfsddgdysdknmia rlngel
Timeline for d4eg3a1: