Lineage for d4eg1a1 (4eg1 A:239-606)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2106026Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2106027Protein automated matches [190459] (50 species)
    not a true protein
  7. 2106228Species Trypanosoma brucei [TaxId:999953] [226467] (27 PDB entries)
  8. 2106247Domain d4eg1a1: 4eg1 A:239-606 [262694]
    Other proteins in same PDB: d4eg1a2, d4eg1b2, d4eg1b3
    automated match to d4mvyb2
    protein/RNA complex; complexed with gol, met

Details for d4eg1a1

PDB Entry: 4eg1 (more details), 2.9 Å

PDB Description: trypanosoma brucei methionyl-trna synthetase in complex with substrate methionine
PDB Compounds: (A:) Methionyl-tRNA synthetase, putative

SCOPe Domain Sequences for d4eg1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eg1a1 c.26.1.0 (A:239-606) automated matches {Trypanosoma brucei [TaxId: 999953]}
ekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkvaeaak
qkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdiylgr
yegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsafrerlle
wyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwldal
tnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsaglpl
pkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdysdknm
iarlngel

SCOPe Domain Coordinates for d4eg1a1:

Click to download the PDB-style file with coordinates for d4eg1a1.
(The format of our PDB-style files is described here.)

Timeline for d4eg1a1: