Lineage for d4dh2b_ (4dh2 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734507Fold a.139: Type I dockerin domain [63445] (1 superfamily)
    tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand
  4. 2734508Superfamily a.139.1: Type I dockerin domain [63446] (2 families) (S)
  5. 2734526Family a.139.1.0: automated matches [191542] (1 protein)
    not a true family
  6. 2734527Protein automated matches [190928] (7 species)
    not a true protein
  7. 2734551Species Clostridium thermocellum [TaxId:203119] [194257] (4 PDB entries)
  8. 2734552Domain d4dh2b_: 4dh2 B: [262692]
    Other proteins in same PDB: d4dh2a1, d4dh2a2, d4dh2c1, d4dh2c2
    automated match to d4fl4g_
    complexed with ca, so4

Details for d4dh2b_

PDB Entry: 4dh2 (more details), 1.75 Å

PDB Description: Crystal structure of Coh-OlpC(Cthe_0452)-Doc435(Cthe_0435) complex: A novel type I Cohesin-Dockerin complex from Clostridium thermocellum ATTC 27405
PDB Compounds: (B:) Dockerin type 1

SCOPe Domain Sequences for d4dh2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dh2b_ a.139.1.0 (B:) automated matches {Clostridium thermocellum [TaxId: 203119]}
avigdvnadgvvnisdyvlmkryilriiadfpadddmwvgdvngdnvindidcnylkryl
lhmirefpknsy

SCOPe Domain Coordinates for d4dh2b_:

Click to download the PDB-style file with coordinates for d4dh2b_.
(The format of our PDB-style files is described here.)

Timeline for d4dh2b_: