Lineage for d4d7ma2 (4d7m A:68-208)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1746767Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 1746768Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 1746769Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 1746971Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species)
  7. 1746972Species Escherichia coli [TaxId:562] [48501] (23 PDB entries)
  8. 1746975Domain d4d7ma2: 4d7m A:68-208 [262691]
    Other proteins in same PDB: d4d7ma1
    complexed with cl, mg, so4, tdc

Details for d4d7ma2

PDB Entry: 4d7m (more details), 1.55 Å

PDB Description: tetr(d) in complex with anhydrotetracycline and magnesium
PDB Compounds: (A:) tetracycline repressor protein class d

SCOPe Domain Sequences for d4d7ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d7ma2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

SCOPe Domain Coordinates for d4d7ma2:

Click to download the PDB-style file with coordinates for d4d7ma2.
(The format of our PDB-style files is described here.)

Timeline for d4d7ma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4d7ma1