![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
![]() | Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) ![]() |
![]() | Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
![]() | Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [48501] (37 PDB entries) |
![]() | Domain d4d7ma2: 4d7m A:68-208 [262691] Other proteins in same PDB: d4d7ma1, d4d7ma3 complexed with cl, mg, so4, tdc |
PDB Entry: 4d7m (more details), 1.55 Å
SCOPe Domain Sequences for d4d7ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4d7ma2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]} lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl hgleslirgfevqltallqiv
Timeline for d4d7ma2: