Lineage for d4d09a_ (4d09 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2737183Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2737184Protein automated matches [190983] (12 species)
    not a true protein
  7. 2737203Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries)
  8. 2737489Domain d4d09a_: 4d09 A: [262683]
    automated match to d4d09c_
    complexed with 788, mg, zn

Details for d4d09a_

PDB Entry: 4d09 (more details), 2.5 Å

PDB Description: pde2a catalytic domain in complex with a brain penetrant inhibitor
PDB Compounds: (A:) cgmp-dependent 3', 5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d4d09a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d09a_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcpt
larfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdl
dhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrml
dlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkt
trkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlf
pkaaelyervasnrehwtkvshkftirglpsnnsldflde

SCOPe Domain Coordinates for d4d09a_:

Click to download the PDB-style file with coordinates for d4d09a_.
(The format of our PDB-style files is described here.)

Timeline for d4d09a_: