Lineage for d4d00f_ (4d00 F:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2267375Protein automated matches [254646] (34 species)
    not a true protein
  7. 2267677Species Influenza virus a/jiangxi- donghu/346/2013 (h10n8) [TaxId:11309] [256760] (1 PDB entry)
  8. 2267680Domain d4d00f_: 4d00 F: [262682]
    Other proteins in same PDB: d4d00a_, d4d00c_, d4d00e_
    automated match to d4d00d_
    complexed with nag, ni

Details for d4d00f_

PDB Entry: 4d00 (more details), 2.5 Å

PDB Description: Haemagglutinin of H10N8 Influenza Virus Isolated from Humans in Complex with Human Receptor Analogue 6'SLN
PDB Compounds: (F:) haemagglutinin ha1

SCOPe Domain Sequences for d4d00f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d00f_ h.3.1.1 (F:) automated matches {Influenza virus a/jiangxi- donghu/346/2013 (h10n8) [TaxId: 11309]}
glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlni

SCOPe Domain Coordinates for d4d00f_:

Click to download the PDB-style file with coordinates for d4d00f_.
(The format of our PDB-style files is described here.)

Timeline for d4d00f_: