SCOPe 2.05: Domain d4d00f_: 4d00 F:

Lineage for d4d00f_ (4d00 F:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (33 species)
   not a true protein

7. Species Influenza virus a/jiangxi- donghu/346/2013 (h10n8) [TaxId:11309] [256760] (1 PDB entry)

8. Domain d4d00f_: 4d00 F: [262682]
   Other proteins in same PDB: d4d00a_, d4d00c_, d4d00e_
   automated match to d4d00d_
   complexed with nag, ni

Details for d4d00f_

PDB Entry: 4d00, 2.5 Å

PDB Description: haemagglutinin of h10n8 influenza virus isolated from humans in complex with human receptor analogue 6'sln

PDB Compounds: (F:) haemagglutinin ha1

SCOPe Domain Sequences for d4d00f_:

Sequence; same for both SEQRES and ATOM records:

>d4d00f_ h.3.1.1 (F:) automated matches {Influenza virus a/jiangxi- donghu/346/2013 (h10n8) [TaxId: 11309]}
glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlni

Timeline for d4d00f_:

• d4d00f_ is new in SCOPe 2.05-stable
  
• d4d00f_ appears in SCOPe 2.06
  
• d4d00f_ appears in the current release, SCOPe 2.08