Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (33 species) not a true protein |
Species Influenza virus a/jiangxi- donghu/346/2013 (h10n8) [TaxId:11309] [256760] (1 PDB entry) |
Domain d4d00f_: 4d00 F: [262682] Other proteins in same PDB: d4d00a_, d4d00c_, d4d00e_ automated match to d4d00d_ complexed with nag, ni |
PDB Entry: 4d00 (more details), 2.5 Å
SCOPe Domain Sequences for d4d00f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4d00f_ h.3.1.1 (F:) automated matches {Influenza virus a/jiangxi- donghu/346/2013 (h10n8) [TaxId: 11309]} glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlni
Timeline for d4d00f_: