SCOPe 2.05: Domain d4cyze_: 4cyz E:

Lineage for d4cyze_ (4cyz E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (24 species)
   not a true protein

7. Species Influenza a virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId:757360] [256747] (1 PDB entry)

8. Domain d4cyze_: 4cyz E: [262670]
   Other proteins in same PDB: d4cyzb_, d4cyzd_, d4cyzf_
   automated match to d4cyza_
   complexed with edo, nag

Details for d4cyze_

PDB Entry: 4cyz, 2.4 Å

PDB Description: structure of the a_mallard_sweden_51_2002 h10 avian haemmaglutinin in complex with avian receptor analog lsta

PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4cyze_:

Sequence; same for both SEQRES and ATOM records:

>d4cyze_ b.19.1.2 (E:) automated matches {Influenza a virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId: 757360]}
dkiclghhavangtivktltneqeevtnatetvestsldrlcmkgrshkdlgnchpigml
igtpacdlhltgtwdtlierenaiaycypgatvneealrqkimesggiskistgftygss
insagttkacmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhpss
tqekndlygtqslsisvgsstyqsnfvpvvgarpqvngqsgridfhwtlvqpgdnitfsh
nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk
yvnkkslmlatgmrnvpe

Timeline for d4cyze_:

• d4cyze_ is new in SCOPe 2.05-stable
  
• d4cyze_ appears in SCOPe 2.06
  
• d4cyze_ appears in the current release, SCOPe 2.08