SCOPe 2.08: Domain d1inca_: 1inc A:

Lineage for d1inca_ (1inc A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (123 PDB entries)

8. Domain d1inca_: 1inc A: [26267]
   complexed with ca, icl, so4

Details for d1inca_

PDB Entry: 1inc, 1.94 Å

PDB Description: crystal structures of the complex of porcine pancreatic elastase with two valine-derived benzoxazinone inhibitors

PDB Compounds: (A:) porcine pancreatic elastase

SCOPe Domain Sequences for d1inca_:

Sequence; same for both SEQRES and ATOM records:

>d1inca_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

Timeline for d1inca_:

• d1inca_ first appeared (with stable ids) in SCOP 1.55, called d1inc__
  
• d1inca_ appears in SCOPe 2.07