Lineage for d4cywe_ (4cyw E:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778695Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 1778696Protein automated matches [227017] (23 species)
    not a true protein
  7. 1778742Species Influenza a virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId:757360] [256744] (2 PDB entries)
  8. 1778748Domain d4cywe_: 4cyw E: [262667]
    Other proteins in same PDB: d4cywb_, d4cywd_, d4cywf_
    automated match to d4f23a1
    complexed with nag

Details for d4cywe_

PDB Entry: 4cyw (more details), 2.6 Å

PDB Description: structure of the a_mallard_sweden_51_2002 h10 avian haemmaglutinin in complex with human receptor analog 6-sln
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4cywe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cywe_ b.19.1.0 (E:) automated matches {Influenza a virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId: 757360]}
ldkiclghhavangtivktltneqeevtnatetvestsldrlcmkgrshkdlgnchpigm
ligtpacdlhltgtwdtlierenaiaycypgatvneealrqkimesggiskistgftygs
sinsagttkacmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhps
stqekndlygtqslsisvgsstyqsnfvpvvgarpqvngqsgridfhwtlvqpgdnitfs
hnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcp
kyvnkkslmlatgmrnvpe

SCOPe Domain Coordinates for d4cywe_:

Click to download the PDB-style file with coordinates for d4cywe_.
(The format of our PDB-style files is described here.)

Timeline for d4cywe_: