SCOPe 2.05: Domain d4cywa_: 4cyw A:

Lineage for d4cywa_ (4cyw A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (23 species)
   not a true protein

7. Species Influenza a virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId:757360] [256744] (2 PDB entries)

8. Domain d4cywa_: 4cyw A: [262665]
   Other proteins in same PDB: d4cywb_, d4cywd_, d4cywf_
   automated match to d4f23a1
   complexed with nag

Details for d4cywa_

PDB Entry: 4cyw, 2.6 Å

PDB Description: structure of the a_mallard_sweden_51_2002 h10 avian haemmaglutinin in complex with human receptor analog 6-sln

PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4cywa_:

Sequence; same for both SEQRES and ATOM records:

>d4cywa_ b.19.1.0 (A:) automated matches {Influenza a virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId: 757360]}
dkiclghhavangtivktltneqeevtnatetvestsldrlcmkgrshkdlgnchpigml
igtpacdlhltgtwdtlierenaiaycypgatvneealrqkimesggiskistgftygss
insagttkacmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhpss
tqekndlygtqslsisvgsstyqsnfvpvvgarpqvngqsgridfhwtlvqpgdnitfsh
nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk
yvnkkslmlatgmrnvpe

Timeline for d4cywa_:

• d4cywa_ is new in SCOPe 2.05-stable
  
• d4cywa_ appears in SCOPe 2.06
  
• d4cywa_ appears in the current release, SCOPe 2.08